Total number of results for Chinchilla chinchilla are 3
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP02640 |
FVNKHLCGSHLVDALYLVCGDRGFFYTPMA
|
30 | Chinchilla chinchilla | Insulin | Insulin B chain | 1175610#Wood S.P., Blundell T.L., Wollmer A., Lazarus N.R., Neville R.W.J.#The relation of conformation and association of insulin to receptor binding; X-ray and circular-dichroism studies on bovine and hystricomorph insulins.# Eur. J. Biochem. 55:531-542(1975). | |
| NP02641 |
GIVDQCCTSICTLYQLENYCN
|
21 | Chinchilla chinchilla | Insulin | Insulin A chain | 1175610#Wood S.P., Blundell T.L., Wollmer A., Lazarus N.R., Neville R.W.J.#The relation of conformation and association of insulin to receptor binding; X-ray and circular-dichroism studies on bovine and hystricomorph insulins.# Eur. J. Biochem. 55:531-542(1975). | |
| NP03940 |
APLEPVYPGDNATPEQMAQYAAEMRRYINMLTRPRY
|
36 | Chinchilla chinchilla | NPY | Pancreatic hormone | 2235678#Eng J., Kleinman W.A., Chu L.S.#Purification of peptide hormones from chinchilla pancreas by chemical assay.# Peptides 11:683-685(1990). |